SCOP 1.67: Domain d1olub2: 1olu B:205-342

Lineage for d1olub2 (1olu B:205-342)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (3 proteins)

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52928] (4 PDB entries)

8. Domain d1olub2: 1olu B:205-342 [93337]
   Other proteins in same PDB: d1olua_, d1olub1
   complexed with gol, k, mg, tdp; mutant

Details for d1olub2

PDB Entry: 1olu, 1.9 Å

PDB Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase

SCOP Domain Sequences for d1olub2:

Sequence; same for both SEQRES and ATOM records:

>d1olub2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

Timeline for d1olub2:

• d1olub2 is new in SCOP 1.67
  
• d1olub2 appears in SCOP 1.69
  
• d1olub2 appears in the current release, SCOPe 2.08