Lineage for d1olub1 (1olu B:2-204)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361662Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
    automatically mapped to Pfam PF02779
  6. 1361670Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)
  7. 1361671Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries)
    Uniprot P21953 52-392
  8. 1361689Domain d1olub1: 1olu B:2-204 [93336]
    Other proteins in same PDB: d1olua_, d1olub2
    complexed with gol, k, mg, tdp

Details for d1olub1

PDB Entry: 1olu (more details), 1.9 Å

PDB Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d1olub1:

Sequence, based on SEQRES records: (download)

>d1olub1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie

Sequence, based on observed residues (ATOM records): (download)

>d1olub1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie

SCOPe Domain Coordinates for d1olub1:

Click to download the PDB-style file with coordinates for d1olub1.
(The format of our PDB-style files is described here.)

Timeline for d1olub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1olub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1olua_