Lineage for d1olta_ (1olt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090118Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) (S)
    common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel
  5. 2090124Family c.1.28.2: Oxygen-independent coproporphyrinogen III oxidase HemN [102118] (1 protein)
    open beta/alpha barrel decorated with additional structures
  6. 2090125Protein Oxygen-independent coproporphyrinogen III oxidase HemN [102119] (1 species)
  7. 2090126Species Escherichia coli [TaxId:562] [102120] (1 PDB entry)
  8. 2090127Domain d1olta_: 1olt A: [93334]
    complexed with sam, sf4

Details for d1olta_

PDB Entry: 1olt (more details), 2.07 Å

PDB Description: coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme.
PDB Compounds: (A:) oxygen-independent coproporphyrinogen III oxidase

SCOPe Domain Sequences for d1olta_:

Sequence, based on SEQRES records: (download)

>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}
qqidwdlaliqkynysgprytsyptalefsedfgeqaflqavaryperplslyvhipfch
klcyfcgcnkivtrqqhkadqyldaleqeivhraplfagrhvsqlhwgggtptylnkaqi
srlmkllrenfqfnadaeisievdpreieldvldhlraegfnrlsmgvqdfnkevqrlvn
reqdeefifallnhareigftstnidliyglpkqtpesfaftlkrvaelnpdrlsvfnya
hlptifaaqrkikdadlpspqqkldilqetiafltqsgyqfigmdhfarpddelavaqre
gvlhrnfqgyttqgdtdllgmgvsaismigdcyaqnqkelkqyyqqvdeqgnalwrgial
trddcirrdvikslicnfrldyspieqqwdllfadyfaedlkllaplakdglvdvdekgi
qvtakgrllirnicmcfdtyl

Sequence, based on observed residues (ATOM records): (download)

>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}
qqidwdlalikyytsyptalefsedfgeqaflqavaryperplslyvhipfchklcyfcg
cnkivtrqqhkadqyldaleqeivhraplfagrhvsqlhwgggtptylnkaqisrlmkll
renfqfnadaeisievdpreieldvldhlraegfnrlsmgvqdfnkevqrlvnreqdeef
ifallnhareigftstnidliyglpkqtpesfaftlkrvaelnpdrlsvfnyahlptifa
aqrkikdadlpspqqkldilqetiafltqsgyqfigmdhfarpddelavaqregvlhrnf
qgyttqgdtdllgmgvsaismigdcyaqnqkelkqyyqqvdeqgnalwrgialtrddcir
rdvikslicnfrldyspieqqwdllfadyfaedlkllaplakdglvdvdekgiqvtakgr
llirnicmcfdtyl

SCOPe Domain Coordinates for d1olta_:

Click to download the PDB-style file with coordinates for d1olta_.
(The format of our PDB-style files is described here.)

Timeline for d1olta_: