SCOP 1.67: Domain d1olla2: 1oll A:96-188

Lineage for d1olla2 (1oll A:96-188)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Ligand binding domain of NK receptor NKp46 [101519] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [101520] (2 PDB entries)

8. Domain d1olla2: 1oll A:96-188 [93314]
   complexed with edo

Details for d1olla2

PDB Entry: 1oll, 1.93 Å

PDB Description: extracellular region of the human receptor nkp46

SCOP Domain Sequences for d1olla2:

Sequence; same for both SEQRES and ATOM records:

>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens)}
mydtptlsvhpgpevisgekvtfycrldtatsmflllkegrsshvqrgygkvqaefplgp
vttahrgtyrcfgsynnhawsfpsepvkllvtg

Timeline for d1olla2:

• d1olla2 is new in SCOP 1.67
  
• d1olla2 appears in SCOP 1.69
  
• d1olla2 appears in the current release, SCOPe 2.08