![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species) OPK group; AIRK subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries) |
![]() | Domain d1ol7a_: 1ol7 A: [93312] complexed with adp, mg |
PDB Entry: 1ol7 (more details), 2.75 Å
SCOPe Domain Sequences for d1ol7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ol7a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy chskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmh dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh npsqrpmlrevlehpwitansskp
Timeline for d1ol7a_: