Lineage for d1ol6a_ (1ol6 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734748Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 734749Species Human (Homo sapiens) [TaxId:9606] [90039] (7 PDB entries)
  8. 734757Domain d1ol6a_: 1ol6 A: [93311]
    complexed with atp; mutant

Details for d1ol6a_

PDB Entry: 1ol6 (more details), 3 Å

PDB Description: Structure of unphosphorylated D274N mutant of Aurora-A
PDB Compounds: (A:) serine/threonine kinase 6

SCOP Domain Sequences for d1ol6a_:

Sequence, based on SEQRES records: (download)

>d1ol6a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
hskrvihrdikpenlllgsagelkianfgwsvhapssrrttlcgtldylppemiegrmhd
ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
psqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d1ol6a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
waledfeigrplgkkfgnvylarekqskfilalkvlfkaqlekaehqlrreveiqshlrh
pnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychsk
rvihrdikpenlllgsagelkianfgwsvhtldylppemiegmhdekvdlwslgvlcyef
lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
itanss

SCOP Domain Coordinates for d1ol6a_:

Click to download the PDB-style file with coordinates for d1ol6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ol6a_: