Lineage for d1ol2d2 (1ol2 D:310-432)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772194Protein Cyclin A [47956] (2 species)
  7. 772294Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
    Uniprot P20248 175-432
  8. 772380Domain d1ol2d2: 1ol2 D:310-432 [93309]
    Other proteins in same PDB: d1ol2a_, d1ol2c_
    complexed with nh2, pff

Details for d1ol2d2

PDB Entry: 1ol2 (more details), 2.6 Å

PDB Description: cyclin a binding groove inhibitor h-arg-arg-leu-asn-(p-f-phe)-nh2
PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d1ol2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ol2d2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1ol2d2:

Click to download the PDB-style file with coordinates for d1ol2d2.
(The format of our PDB-style files is described here.)

Timeline for d1ol2d2: