SCOPe 2.02: Domain d1ol0b_: 1ol0 B:

Lineage for d1ol0b_ (1ol0 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1ol0b_: 1ol0 B: [93297]
   camelized human VH
   complexed with gol, so4

Details for d1ol0b_

PDB Entry: 1ol0, 1.8 Å

PDB Description: crystal structure of a camelised human vh

PDB Compounds: (B:) immunoglobulin g

SCOPe Domain Sequences for d1ol0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ol0b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
s

Timeline for d1ol0b_:

• d1ol0b_ first appeared in SCOP 1.67
  
• d1ol0b_ appears in SCOPe 2.01
  
• d1ol0b_ appears in SCOPe 2.03
  
• d1ol0b_ appears in the current release, SCOPe 2.08