Lineage for d1ol0b_ (1ol0 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 450917Species Engineered (including hybrid species) [88562] (31 PDB entries)
  8. 450919Domain d1ol0b_: 1ol0 B: [93297]
    camelized human VH

Details for d1ol0b_

PDB Entry: 1ol0 (more details), 1.8 Å

PDB Description: crystal structure of a camelised human vh

SCOP Domain Sequences for d1ol0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ol0b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
s

SCOP Domain Coordinates for d1ol0b_:

Click to download the PDB-style file with coordinates for d1ol0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ol0b_: