SCOPe 2.01: Domain d1okxa_: 1okx A:

Lineage for d1okxa_ (1okx A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (114 PDB entries)

8. Domain d1okxa_: 1okx A: [93294]

Details for d1okxa_

PDB Entry: 1okx, 2.8 Å

PDB Description: binding structure of elastase inhibitor scyptolin a

PDB Compounds: (A:) Elastase 1

SCOPe Domain Sequences for d1okxa_:

Sequence; same for both SEQRES and ATOM records:

>d1okxa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1okxa_:

• d1okxa_ first appeared in SCOP 1.67
  
• d1okxa_ appears in SCOP 1.75
  
• d1okxa_ appears in SCOPe 2.02
  
• d1okxa_ appears in the current release, SCOPe 2.08