Lineage for d1oktb2 (1okt B:1-85)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1853392Protein Pf GST [102442] (1 species)
    cannot be assigned to any of the known GST classes
  7. 1853393Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries)
  8. 1853395Domain d1oktb2: 1okt B:1-85 [93275]
    Other proteins in same PDB: d1okta1, d1oktb1
    complexed with fmt

Details for d1oktb2

PDB Entry: 1okt (more details), 1.9 Å

PDB Description: x-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1oktb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oktb2 c.47.1.5 (B:1-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d1oktb2:

Click to download the PDB-style file with coordinates for d1oktb2.
(The format of our PDB-style files is described here.)

Timeline for d1oktb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oktb1