SCOP 1.67: Domain d1oktb2: 1okt B:1-85

Lineage for d1oktb2 (1okt B:1-85)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Pf GST [102442] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (3 PDB entries)

8. Domain d1oktb2: 1okt B:1-85 [93275]
   Other proteins in same PDB: d1okta1, d1oktb1
   complexed with fmt

Details for d1oktb2

PDB Entry: 1okt, 1.9 Å

PDB Description: x-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum

SCOP Domain Sequences for d1oktb2:

Sequence; same for both SEQRES and ATOM records:

>d1oktb2 c.47.1.5 (B:1-85) Pf GST {Malarial parasite (Plasmodium falciparum)}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni

Timeline for d1oktb2:

• d1oktb2 is new in SCOP 1.67
  
• d1oktb2 appears in SCOP 1.69
  
• d1oktb2 appears in the current release, SCOPe 2.08