Lineage for d1oktb1 (1okt B:86-211)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326664Protein Pf GST [101210] (1 species)
    cannot be assigned to any of the known GST classes
  7. 2326665Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries)
  8. 2326667Domain d1oktb1: 1okt B:86-211 [93274]
    Other proteins in same PDB: d1okta2, d1oktb2
    complexed with fmt

Details for d1oktb1

PDB Entry: 1okt (more details), 1.9 Å

PDB Description: x-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1oktb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oktb1 a.45.1.1 (B:86-211) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

SCOPe Domain Coordinates for d1oktb1:

Click to download the PDB-style file with coordinates for d1oktb1.
(The format of our PDB-style files is described here.)

Timeline for d1oktb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oktb2