Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Pf GST [102442] (1 species) cannot be assigned to any of the known GST classes |
Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (3 PDB entries) |
Domain d1okta2: 1okt A:1-85 [93273] Other proteins in same PDB: d1okta1, d1oktb1 |
PDB Entry: 1okt (more details), 1.9 Å
SCOP Domain Sequences for d1okta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum)} mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp ilqigdlilaqsqaivrylskkyni
Timeline for d1okta2: