![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.5: Phosphoprotein XD domain [101089] (1 family) ![]() |
![]() | Family a.8.5.1: Phosphoprotein XD domain [101090] (1 protein) |
![]() | Protein RNA polymerase alpha subunit [101091] (2 species) |
![]() | Species Measles virus [TaxId:11234] [101092] (2 PDB entries) |
![]() | Domain d1oksa_: 1oks A: [93271] |
PDB Entry: 1oks (more details), 1.8 Å
SCOP Domain Sequences for d1oksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oksa_ a.8.5.1 (A:) RNA polymerase alpha subunit {Measles virus} asrsvirsiikssrleedrkrylmtllddikgandlakfhqmlvkiimkhhhhh
Timeline for d1oksa_: