![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.5: Phosphoprotein XD domain [101089] (1 family) ![]() |
![]() | Family a.8.5.1: Phosphoprotein XD domain [101090] (1 protein) |
![]() | Protein RNA polymerase alpha subunit [101091] (2 species) |
![]() | Species Measles virus [TaxId:11234] [101092] (3 PDB entries) Uniprot Q89728 459-507 |
![]() | Domain d1oksa1: 1oks A:2-50 [93271] Other proteins in same PDB: d1oksa2 complexed with nhe |
PDB Entry: 1oks (more details), 1.8 Å
SCOPe Domain Sequences for d1oksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oksa1 a.8.5.1 (A:2-50) RNA polymerase alpha subunit {Measles virus [TaxId: 11234]} asrsvirsiikssrleedrkrylmtllddikgandlakfhqmlvkiimk
Timeline for d1oksa1: