Lineage for d1okqa2 (1okq A:2933-3117)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) 
Family b.29.1.4: Laminin G-like module [49944] (5 proteins) 
Protein Laminin alpha2 chain [49947] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49948] (3 PDB entries) 
Domain d1okqa2: 1okq A:2933-3117 [93268]
lg4-5 domain pair
Details for d1okqa2
PDB Entry: 1okq (more details), 2 Å
PDB Description: laminin alpha 2 chain lg4-5 domain pair, ca1 site mutant
SCOP Domain Sequences for d1okqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okqa2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus)}
naesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdgmgiemidek
lmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsast
sadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqp
vscpt
SCOP Domain Coordinates for d1okqa2:
Click to download the PDB-style file with coordinates for d1okqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1okqa2:
- d1okqa2 first appeared in SCOP 1.67
- d1okqa2 appears in SCOP 1.71
- d1okqa2 appears in the current release, SCOPe 2.08
View in 3D
