Lineage for d1okqa2 (1okq A:2933-3117)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371645Family b.29.1.4: Laminin G-like module [49944] (5 proteins)
  6. 371661Protein Laminin alpha2 chain [49947] (1 species)
  7. 371662Species Mouse (Mus musculus) [TaxId:10090] [49948] (3 PDB entries)
  8. 371664Domain d1okqa2: 1okq A:2933-3117 [93268]
    lg4-5 domain pair
    complexed with ca; mutant

Details for d1okqa2

PDB Entry: 1okq (more details), 2 Å

PDB Description: laminin alpha 2 chain lg4-5 domain pair, ca1 site mutant

SCOP Domain Sequences for d1okqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okqa2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus)}
naesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdgmgiemidek
lmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsast
sadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqp
vscpt

SCOP Domain Coordinates for d1okqa2:

Click to download the PDB-style file with coordinates for d1okqa2.
(The format of our PDB-style files is described here.)

Timeline for d1okqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okqa1