Lineage for d1okob_ (1oko B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370246Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 370247Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families) (S)
  5. 370518Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
  6. 370519Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 370520Species Pseudomonas aeruginosa [TaxId:287] [82024] (3 PDB entries)
  8. 370523Domain d1okob_: 1oko B: [93264]

Details for d1okob_

PDB Entry: 1oko (more details), 1.6 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin 1 complexed with galactose at 1.6 a resolution

SCOP Domain Sequences for d1okob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okob_ b.18.1.16 (B:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOP Domain Coordinates for d1okob_:

Click to download the PDB-style file with coordinates for d1okob_.
(The format of our PDB-style files is described here.)

Timeline for d1okob_: