SCOPe 2.06: Domain d1okkd2: 1okk D:97-303

Lineage for d1okkd2 (1okk D:97-303)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)

7. Species Thermus aquaticus [TaxId:271] [102374] (3 PDB entries)

8. Domain d1okkd2: 1okk D:97-303 [93262]
   Other proteins in same PDB: d1okka1, d1okka2, d1okkd1
   complexed with bzp, edo, gcp, mg, so4

Details for d1okkd2

PDB Entry: 1okk, 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases

PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d1okkd2:

Sequence; same for both SEQRES and ATOM records:

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

Timeline for d1okkd2:

• d1okkd2 first appeared in SCOP 1.67
  
• d1okkd2 appears in SCOPe 2.05
  
• d1okkd2 appears in SCOPe 2.07
  
• d1okkd2 appears in the current release, SCOPe 2.08