SCOP 1.73: Domain d1okkd1: 1okk D:21-78

Lineage for d1okkd1 (1okk D:21-78)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal recognition particle receptor, FtsY [47368] (3 species)

7. Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries)

8. Domain d1okkd1: 1okk D:21-78 [93261]
   Other proteins in same PDB: d1okka1, d1okka2, d1okkd2
   complexed with bzp, edo, gcp, mo3, so4

Details for d1okkd1

PDB Entry: 1okk, 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases

PDB Compounds: (D:) cell division protein ftsy

SCOP Domain Sequences for d1okkd1:

Sequence; same for both SEQRES and ATOM records:

>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Timeline for d1okkd1:

• d1okkd1 first appeared in SCOP 1.67
  
• d1okkd1 appears in SCOP 1.71
  
• d1okkd1 appears in SCOP 1.75
  
• d1okkd1 appears in the current release, SCOPe 2.08