![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) ![]() |
![]() | Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
![]() | Protein Signal recognition particle receptor, FtsY [47368] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries) |
![]() | Domain d1okkd1: 1okk D:21-78 [93261] Other proteins in same PDB: d1okka1, d1okka2, d1okkd2 complexed with bzp, edo, gcp, mo3, so4 |
PDB Entry: 1okk (more details), 2.05 Å
SCOP Domain Sequences for d1okkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okkd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]} aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep
Timeline for d1okkd1: