SCOPe 2.07: Domain d1okka2: 1okk A:89-293

Lineage for d1okka2 (1okk A:89-293)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (16 PDB entries)

8. Domain d1okka2: 1okk A:89-293 [93260]
   Other proteins in same PDB: d1okka1, d1okkd1, d1okkd2
   complexed with bzp, edo, gcp, mg, so4

Details for d1okka2

PDB Entry: 1okk, 2.05 Å

PDB Description: homo-heterodimeric complex of the srp gtpases

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1okka2:

Sequence; same for both SEQRES and ATOM records:

>d1okka2 c.37.1.10 (A:89-293) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilg

Timeline for d1okka2:

• d1okka2 first appeared in SCOP 1.67
  
• d1okka2 appears in SCOPe 2.06
  
• d1okka2 appears in the current release, SCOPe 2.08