SCOP 1.71: Domain d1okib2: 1oki B:145-237

Lineage for d1okib2 (1oki B:145-237)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [101572] (1 PDB entry)

8. Domain d1okib2: 1oki B:145-237 [93258]

Details for d1okib2

PDB Entry: 1oki, 1.4 Å

PDB Description: crystal structure of truncated human beta-b1-crystallin

SCOP Domain Sequences for d1okib2:

Sequence; same for both SEQRES and ATOM records:

>d1okib2 b.11.1.1 (B:145-237) beta-Crystallin {Human (Homo sapiens)}
aqehkislfeganfkgntieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyq
yllepgdfrhwnewgafqpqmqslrrlrdkqwh

Timeline for d1okib2:

• d1okib2 first appeared in SCOP 1.67
  
• d1okib2 appears in SCOP 1.69
  
• d1okib2 appears in SCOP 1.73
  
• d1okib2 appears in the current release, SCOPe 2.08