![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) ![]() |
![]() | Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) |
![]() | Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101572] (1 PDB entry) |
![]() | Domain d1okib2: 1oki B:145-237 [93258] |
PDB Entry: 1oki (more details), 1.4 Å
SCOP Domain Sequences for d1okib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okib2 b.11.1.1 (B:145-237) beta-Crystallin {Human (Homo sapiens)} aqehkislfeganfkgntieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyq yllepgdfrhwnewgafqpqmqslrrlrdkqwh
Timeline for d1okib2: