Lineage for d1okib2 (1oki B:145-237)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369998Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 369999Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 370000Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 370001Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 370013Species Human (Homo sapiens) [TaxId:9606] [101572] (1 PDB entry)
  8. 370017Domain d1okib2: 1oki B:145-237 [93258]

Details for d1okib2

PDB Entry: 1oki (more details), 1.4 Å

PDB Description: crystal structure of truncated human beta-b1-crystallin

SCOP Domain Sequences for d1okib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okib2 b.11.1.1 (B:145-237) beta-Crystallin {Human (Homo sapiens)}
aqehkislfeganfkgntieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyq
yllepgdfrhwnewgafqpqmqslrrlrdkqwh

SCOP Domain Coordinates for d1okib2:

Click to download the PDB-style file with coordinates for d1okib2.
(The format of our PDB-style files is described here.)

Timeline for d1okib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okib1