SCOP 1.69: Domain d1okib1: 1oki B:54-144

Lineage for d1okib1 (1oki B:54-144)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [101572] (1 PDB entry)

8. Domain d1okib1: 1oki B:54-144 [93257]

Details for d1okib1

PDB Entry: 1oki, 1.4 Å

PDB Description: crystal structure of truncated human beta-b1-crystallin

SCOP Domain Sequences for d1okib1:

Sequence; same for both SEQRES and ATOM records:

>d1okib1 b.11.1.1 (B:54-144) beta-Crystallin {Human (Homo sapiens)}
ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf
ilekgeyprwntwsssyrsdrlmsfrpikmd

Timeline for d1okib1:

• d1okib1 first appeared in SCOP 1.67
  
• d1okib1 appears in SCOP 1.71
  
• d1okib1 appears in the current release, SCOPe 2.08