Lineage for d1okia1 (1oki A:54-144)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776437Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 1776438Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 1776439Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 1776440Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 1776452Species Human (Homo sapiens) [TaxId:9606] [101572] (2 PDB entries)
  8. 1776453Domain d1okia1: 1oki A:54-144 [93255]

Details for d1okia1

PDB Entry: 1oki (more details), 1.4 Å

PDB Description: crystal structure of truncated human beta-b1-crystallin
PDB Compounds: (A:) beta crystallin b1

SCOPe Domain Sequences for d1okia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okia1 b.11.1.1 (A:54-144) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]}
ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf
ilekgeyprwntwsssyrsdrlmsfrpikmd

SCOPe Domain Coordinates for d1okia1:

Click to download the PDB-style file with coordinates for d1okia1.
(The format of our PDB-style files is described here.)

Timeline for d1okia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okia2