Class b: All beta proteins [48724] (176 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein beta-Crystallin [49702] (4 species) duplication consists of two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [101572] (2 PDB entries) |
Domain d1okia1: 1oki A:54-144 [93255] |
PDB Entry: 1oki (more details), 1.4 Å
SCOPe Domain Sequences for d1okia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okia1 b.11.1.1 (A:54-144) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]} ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf ilekgeyprwntwsssyrsdrlmsfrpikmd
Timeline for d1okia1: