Lineage for d1okga3 (1okg A:302-373)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941686Family d.26.1.3: 3-mercaptopyruvate sulfurtransferase, C-terminal domain [102868] (1 protein)
    automatically mapped to Pfam PF09122
  6. 2941687Protein 3-mercaptopyruvate sulfurtransferase, C-terminal domain [102869] (1 species)
  7. 2941688Species Leishmania major [TaxId:5664] [102870] (1 PDB entry)
  8. 2941689Domain d1okga3: 1okg A:302-373 [93252]
    Other proteins in same PDB: d1okga1, d1okga2
    complexed with ca, so3

Details for d1okga3

PDB Entry: 1okg (more details), 2.1 Å

PDB Description: 3-mercaptopyruvate sulfurtransferase from leishmania major
PDB Compounds: (A:) possible 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d1okga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okga3 d.26.1.3 (A:302-373) 3-mercaptopyruvate sulfurtransferase, C-terminal domain {Leishmania major [TaxId: 5664]}
mcmqmqtpslgdnpkanldtmtlkvdgapcerpdaevqsaathlhageaatvyfksgrvv
tievpvvpnlea

SCOPe Domain Coordinates for d1okga3:

Click to download the PDB-style file with coordinates for d1okga3.
(The format of our PDB-style files is described here.)

Timeline for d1okga3: