![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.3: 3-mercaptopyruvate sulfurtransferase, C-terminal domain [102868] (1 protein) automatically mapped to Pfam PF09122 |
![]() | Protein 3-mercaptopyruvate sulfurtransferase, C-terminal domain [102869] (1 species) |
![]() | Species Leishmania major [TaxId:5664] [102870] (1 PDB entry) |
![]() | Domain d1okga3: 1okg A:302-373 [93252] Other proteins in same PDB: d1okga1, d1okga2 complexed with ca, so3 |
PDB Entry: 1okg (more details), 2.1 Å
SCOPe Domain Sequences for d1okga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okga3 d.26.1.3 (A:302-373) 3-mercaptopyruvate sulfurtransferase, C-terminal domain {Leishmania major [TaxId: 5664]} mcmqmqtpslgdnpkanldtmtlkvdgapcerpdaevqsaathlhageaatvyfksgrvv tievpvvpnlea
Timeline for d1okga3: