Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Tryparedoxin I [52904] (2 species) |
Species Crithidia fasciculata [TaxId:5656] [52905] (8 PDB entries) |
Domain d1okda1: 1okd A:2-146 [93249] Other proteins in same PDB: d1okda2 |
PDB Entry: 1okd (more details)
SCOPe Domain Sequences for d1okda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okda1 c.47.1.10 (A:2-146) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd vvttraratlvkdpegeqfpwkdap
Timeline for d1okda1: