SCOPe 2.07: Domain d1okda1: 1okd A:2-146

Lineage for d1okda1 (1okd A:2-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Tryparedoxin I [52904] (2 species)

7. Species Crithidia fasciculata [TaxId:5656] [52905] (8 PDB entries)

8. Domain d1okda1: 1okd A:2-146 [93249]
   Other proteins in same PDB: d1okda2

Details for d1okda1

PDB Entry: 1okd

PDB Description: nmr-structure of tryparedoxin 1

PDB Compounds: (A:) tryparedoxin 1

SCOPe Domain Sequences for d1okda1:

Sequence; same for both SEQRES and ATOM records:

>d1okda1 c.47.1.10 (A:2-146) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]}
sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
vvttraratlvkdpegeqfpwkdap

Timeline for d1okda1:

• d1okda1 first appeared in SCOP 1.67, called d1okda_
  
• d1okda1 appears in SCOPe 2.06
  
• d1okda1 appears in the current release, SCOPe 2.08