SCOPe 2.08: Domain d1okbb_: 1okb B:

Lineage for d1okbb_ (1okb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (2 PDB entries)

8. Domain d1okbb_: 1okb B: [93247]
   complexed with cl, gol

Details for d1okbb_

PDB Entry: 1okb, 1.9 Å

PDB Description: crystal structure of uracil-dna glycosylase from atlantic cod (gadus morhua)

PDB Compounds: (B:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1okbb_:

Sequence; same for both SEQRES and ATOM records:

>d1okbb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua) [TaxId: 8049]}
meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
hvlqavhpsplsahrgflgckhfskangllklsgtepinwral

Timeline for d1okbb_:

• d1okbb_ first appeared in SCOP 1.67
  
• d1okbb_ appears in SCOPe 2.07