SCOPe 2.07: Domain d1ok9b4: 1ok9 B:191-254

Lineage for d1ok9b4 (1ok9 B:191-254)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)

8. Domain d1ok9b4: 1ok9 B:191-254 [93245]
   intact protein
   complexed with act, cl, gol, pt, so4

Details for d1ok9b4

PDB Entry: 1ok9, 3 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

PDB Compounds: (B:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ok9b4:

Sequence; same for both SEQRES and ATOM records:

>d1ok9b4 g.18.1.1 (B:191-254) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crgc

Timeline for d1ok9b4:

• d1ok9b4 first appeared in SCOP 1.67
  
• d1ok9b4 appears in SCOPe 2.06
  
• d1ok9b4 appears in the current release, SCOPe 2.08