| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
| Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species) |
| Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries) |
| Domain d1ok6i_: 1ok6 I: [93234] complexed with gol |
PDB Entry: 1ok6 (more details), 2.4 Å
SCOPe Domain Sequences for d1ok6i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ok6i_ c.1.10.1 (I:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]}
anltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfq
rgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfew
kmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikyt
gdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdal
kfaralaelvyg
Timeline for d1ok6i_: