Lineage for d1ok6c_ (1ok6 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972171Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 972190Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 972191Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. 972225Domain d1ok6c_: 1ok6 C: [93228]
    complexed with gol

Details for d1ok6c_

PDB Entry: 1ok6 (more details), 2.4 Å

PDB Description: orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase
PDB Compounds: (C:) fructose-bisphosphate aldolase class I

SCOPe Domain Sequences for d1ok6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok6c_ c.1.10.1 (C:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]}
anltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfq
rgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfew
kmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikyt
gdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdal
kfaralaelvyg

SCOPe Domain Coordinates for d1ok6c_:

Click to download the PDB-style file with coordinates for d1ok6c_.
(The format of our PDB-style files is described here.)

Timeline for d1ok6c_: