Lineage for d1ok4e_ (1ok4 E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817253Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 817272Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 817273Species Archaeon Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. 817308Domain d1ok4e_: 1ok4 E: [93220]

Details for d1ok4e_

PDB Entry: 1ok4 (more details), 2.1 Å

PDB Description: archaeal fructose 1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate
PDB Compounds: (E:) fructose-bisphosphate aldolase class I

SCOP Domain Sequences for d1ok4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok4e_ c.1.10.1 (E:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvyggk

SCOP Domain Coordinates for d1ok4e_:

Click to download the PDB-style file with coordinates for d1ok4e_.
(The format of our PDB-style files is described here.)

Timeline for d1ok4e_: