Lineage for d1ok1b2 (1ok1 B:65-128)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638857Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 2638858Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)
  8. 2638886Domain d1ok1b2: 1ok1 B:65-128 [93197]
    intact protein
    complexed with act, gol, so4

Details for d1ok1b2

PDB Entry: 1ok1 (more details), 2.6 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.
PDB Compounds: (B:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ok1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok1b2 g.18.1.1 (B:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
scevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstave
fckk

SCOPe Domain Coordinates for d1ok1b2:

Click to download the PDB-style file with coordinates for d1ok1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ok1b2: