Lineage for d1ok1b1 (1ok1 B:2-64)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623526Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 623527Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 623528Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
    Pfam 00084
  6. 623606Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)
  7. 623607Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)
  8. 623634Domain d1ok1b1: 1ok1 B:2-64 [93196]

Details for d1ok1b1

PDB Entry: 1ok1 (more details), 2.6 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

SCOP Domain Sequences for d1ok1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok1b1 g.18.1.1 (B:2-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
qdcglppdvpnaqpalegrtsfpedtvitykceesfvkipgekdsviclkgsqwsdieef
cnr

SCOP Domain Coordinates for d1ok1b1:

Click to download the PDB-style file with coordinates for d1ok1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ok1b1: