Lineage for d1ojza_ (1ojz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000485Protein Exoenzyme c3 [56414] (4 species)
  7. 3000513Species Staphylococcus aureus [TaxId:1280] [103338] (2 PDB entries)
  8. 3000514Domain d1ojza_: 1ojz A: [93190]
    complexed with nad

Details for d1ojza_

PDB Entry: 1ojz (more details), 2.02 Å

PDB Description: the crystal structure of c3stau2 from s. aureus in with nad
PDB Compounds: (A:) ADP-ribosyltransferase

SCOPe Domain Sequences for d1ojza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojza_ d.166.1.1 (A:) Exoenzyme c3 {Staphylococcus aureus [TaxId: 1280]}
aetknftdlveatkwgnsliksakysskdkmaiynytknsspintplrsangdvnklsen
iqeqvrqldstisksvtpdsvyvyrllnldylssitgftredlhmlqqtnngqynealvs
klnnlmnsriyrengysstqlvsgaalagrpielklelpkgtkaayidskeltaypgqqe
vllprgteyavgsvklsdnkrkiiitavvfkk

SCOPe Domain Coordinates for d1ojza_:

Click to download the PDB-style file with coordinates for d1ojza_.
(The format of our PDB-style files is described here.)

Timeline for d1ojza_: