SCOPe 2.07: Domain d1ojyc4: 1ojy C:191-253

Lineage for d1ojyc4 (1ojy C:191-253)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)

8. Domain d1ojyc4: 1ojy C:191-253 [93185]
   intact protein
   complexed with act, gol, so4

Details for d1ojyc4

PDB Entry: 1ojy, 2.6 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

PDB Compounds: (C:) complement decay-accelerating factor

SCOPe Domain Sequences for d1ojyc4:

Sequence; same for both SEQRES and ATOM records:

>d1ojyc4 g.18.1.1 (C:191-253) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

Timeline for d1ojyc4:

• d1ojyc4 first appeared in SCOP 1.67
  
• d1ojyc4 appears in SCOPe 2.06
  
• d1ojyc4 appears in the current release, SCOPe 2.08