Lineage for d1ojxf_ (1ojx F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834424Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 2834425Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. 2834432Domain d1ojxf_: 1ojx F: [93169]

Details for d1ojxf_

PDB Entry: 1ojx (more details), 1.9 Å

PDB Description: crystal structure of an archaeal fructose 1,6-bisphosphate aldolase
PDB Compounds: (F:) fructose-bisphosphate aldolase class I

SCOPe Domain Sequences for d1ojxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojxf_ c.1.10.1 (F:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvyg

SCOPe Domain Coordinates for d1ojxf_:

Click to download the PDB-style file with coordinates for d1ojxf_.
(The format of our PDB-style files is described here.)

Timeline for d1ojxf_: