Lineage for d1ojxe_ (1ojx E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972171Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 972190Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 972191Species Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries)
  8. 972196Domain d1ojxe_: 1ojx E: [93168]

Details for d1ojxe_

PDB Entry: 1ojx (more details), 1.9 Å

PDB Description: crystal structure of an archaeal fructose 1,6-bisphosphate aldolase
PDB Compounds: (E:) fructose-bisphosphate aldolase class I

SCOPe Domain Sequences for d1ojxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojxe_ c.1.10.1 (E:) Archaeal fructose 1,6-bisphosphate aldolase {Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvyggk

SCOPe Domain Coordinates for d1ojxe_:

Click to download the PDB-style file with coordinates for d1ojxe_.
(The format of our PDB-style files is described here.)

Timeline for d1ojxe_: