| Class g: Small proteins [56992] (98 folds) |
| Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
| Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
| Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries) |
| Domain d1ojvb2: 1ojv B:65-128 [93153] intact protein complexed with act, gol, so4 |
PDB Entry: 1ojv (more details), 2.3 Å
SCOPe Domain Sequences for d1ojvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojvb2 g.18.1.1 (B:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
scevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstave
fckk
Timeline for d1ojvb2:
View in 3DDomains from other chains: (mouse over for more information) d1ojva1, d1ojva2, d1ojva3, d1ojva4 |