Lineage for d1ojpa2 (1ojp A:815-892)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370953Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 370954Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 370955Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 370973Protein Hyaluronate lyase [49867] (2 species)
  7. 370978Species Streptococcus pneumoniae [TaxId:1313] [49868] (14 PDB entries)
  8. 370988Domain d1ojpa2: 1ojp A:815-892 [93144]
    Other proteins in same PDB: d1ojpa1, d1ojpa3
    complexed with dgc, ng6, so4

Details for d1ojpa2

PDB Entry: 1ojp (more details), 1.9 Å

PDB Description: specificity and mechanism of streptococcus pneumoniae hyaluronate lyase: complex with 6-sulphated chondroitin disaccharide

SCOP Domain Sequences for d1ojpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojpa2 b.24.1.1 (A:815-892) Hyaluronate lyase {Streptococcus pneumoniae}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkleq

SCOP Domain Coordinates for d1ojpa2:

Click to download the PDB-style file with coordinates for d1ojpa2.
(The format of our PDB-style files is described here.)

Timeline for d1ojpa2: