Lineage for d1ojpa1 (1ojp A:170-540)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 359047Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 359053Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 359071Protein Hyaluronate lyase [48237] (2 species)
  7. 359076Species Streptococcus pneumoniae [TaxId:1313] [48238] (14 PDB entries)
  8. 359086Domain d1ojpa1: 1ojp A:170-540 [93143]
    Other proteins in same PDB: d1ojpa2, d1ojpa3
    complexed with dgc, ng6, so4

Details for d1ojpa1

PDB Entry: 1ojp (more details), 1.9 Å

PDB Description: specificity and mechanism of streptococcus pneumoniae hyaluronate lyase: complex with 6-sulphated chondroitin disaccharide

SCOP Domain Sequences for d1ojpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojpa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOP Domain Coordinates for d1ojpa1:

Click to download the PDB-style file with coordinates for d1ojpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ojpa1: