Lineage for d1ojna3 (1ojn A:541-814)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 460936Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 460954Protein Hyaluronate lyase [50009] (2 species)
  7. 460959Species Streptococcus pneumoniae [TaxId:1313] [50010] (15 PDB entries)
  8. 460964Domain d1ojna3: 1ojn A:541-814 [93139]
    Other proteins in same PDB: d1ojna1, d1ojna2

Details for d1ojna3

PDB Entry: 1ojn (more details), 1.6 Å

PDB Description: specificity and mechanism of streptococcus pneumoniae hyaluronate lyase: complex of the tyr408phe mutant with 6-sulphated chondroitin disaccharide

SCOP Domain Sequences for d1ojna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojna3 b.30.5.2 (A:541-814) Hyaluronate lyase {Streptococcus pneumoniae}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOP Domain Coordinates for d1ojna3:

Click to download the PDB-style file with coordinates for d1ojna3.
(The format of our PDB-style files is described here.)

Timeline for d1ojna3: