Lineage for d1ojma1 (1ojm A:170-540)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743180Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 1743192Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 1743210Protein Hyaluronate lyase [48237] (2 species)
  7. 1743211Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [48238] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 1743220Domain d1ojma1: 1ojm A:170-540 [93134]
    Other proteins in same PDB: d1ojma2, d1ojma3
    complexed with so4

Details for d1ojma1

PDB Entry: 1ojm (more details), 1.78 Å

PDB Description: specificity and mechanism of streptococcus pneumoniae hyaluronate lyase: complex with unsulphated chondroitin disaccharide
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1ojma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojma1 a.102.3.2 (A:170-540) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOPe Domain Coordinates for d1ojma1:

Click to download the PDB-style file with coordinates for d1ojma1.
(The format of our PDB-style files is described here.)

Timeline for d1ojma1: