Lineage for d1ojga_ (1ojg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970928Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)
  6. 2970929Protein Fumarate sensor DcuS [103194] (1 species)
  7. 2970930Species Escherichia coli [TaxId:562] [103195] (1 PDB entry)
  8. 2970931Domain d1ojga_: 1ojg A: [93128]

Details for d1ojga_

PDB Entry: 1ojg (more details)

PDB Description: sensory domain of the membraneous two-component fumarate sensor dcus of e. coli
PDB Compounds: (A:) Sensor protein dcuS

SCOPe Domain Sequences for d1ojga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojga_ d.110.6.1 (A:) Fumarate sensor DcuS {Escherichia coli [TaxId: 562]}
sdmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmq
slryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvva
iglelsrvtqqindsr

SCOPe Domain Coordinates for d1ojga_:

Click to download the PDB-style file with coordinates for d1ojga_.
(The format of our PDB-style files is described here.)

Timeline for d1ojga_: