SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ojdf2 (1ojd F:290-401)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161032Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2161033Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2161246Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 protein domains)
  6. 2161299Protein Monoamine oxidase B [69673] (2 species)
  7. 2161300Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries)
  8. 2161380Domain d1ojdf2: 1ojd F:290-401 [93119]
    Other proteins in same PDB: d1ojda1, d1ojdb1, d1ojdc1, d1ojdd1, d1ojde1, d1ojdf1, d1ojdg1, d1ojdh1, d1ojdi1, d1ojdl1
    complexed with fad, lda

Details for d1ojdf2

PDB Entry: 1ojd (more details), 3.1 Å

PDB Description: human monoamine oxidase b in complex with lauryldimethylamine-n-oxide (ldao)
PDB Compounds: (F:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1ojdf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojdf2 d.16.1.5 (F:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d1ojdf2:

Click to download the PDB-style file with coordinates for d1ojdf2.
(The format of our PDB-style files is described here.)

Timeline for d1ojdf2: