Lineage for d1ojcb2 (1ojc B:290-401)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019250Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1019251Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1019452Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 1019486Protein Monoamine oxidase B [69673] (2 species)
  7. 1019487Species Human (Homo sapiens) [TaxId:9606] [69674] (15 PDB entries)
  8. 1019513Domain d1ojcb2: 1ojc B:290-401 [93107]
    Other proteins in same PDB: d1ojca1, d1ojcb1
    complexed with fad, laz

Details for d1ojcb2

PDB Entry: 1ojc (more details), 2.4 Å

PDB Description: human monoamine oxidase b in complex with n-(2-aminoethyl)-p-chlorobenzamide
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1ojcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojcb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOPe Domain Coordinates for d1ojcb2:

Click to download the PDB-style file with coordinates for d1ojcb2.
(The format of our PDB-style files is described here.)

Timeline for d1ojcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojcb1