Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69674] (10 PDB entries) |
Domain d1ojcb2: 1ojc B:290-401 [93107] Other proteins in same PDB: d1ojca1, d1ojcb1 complexed with fad, laz |
PDB Entry: 1ojc (more details), 2.4 Å
SCOP Domain Sequences for d1ojcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojcb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens)} plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d1ojcb2: