Lineage for d1ojcb2 (1ojc B:290-401)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599429Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 599430Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 599586Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 599606Protein Monoamine oxidase B [69673] (2 species)
  7. 599607Species Human (Homo sapiens) [TaxId:9606] [69674] (10 PDB entries)
  8. 599623Domain d1ojcb2: 1ojc B:290-401 [93107]
    Other proteins in same PDB: d1ojca1, d1ojcb1
    complexed with fad, laz

Details for d1ojcb2

PDB Entry: 1ojc (more details), 2.4 Å

PDB Description: human monoamine oxidase b in complex with n-(2-aminoethyl)-p-chlorobenzamide

SCOP Domain Sequences for d1ojcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojcb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens)}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1ojcb2:

Click to download the PDB-style file with coordinates for d1ojcb2.
(The format of our PDB-style files is described here.)

Timeline for d1ojcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojcb1