Lineage for d1ojca1 (1ojc A:3-289,A:402-501)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688822Protein Monoamine oxidase B [69423] (2 species)
  7. 688823Species Human (Homo sapiens) [TaxId:9606] [69424] (10 PDB entries)
  8. 688836Domain d1ojca1: 1ojc A:3-289,A:402-501 [93104]
    Other proteins in same PDB: d1ojca2, d1ojcb2

Details for d1ojca1

PDB Entry: 1ojc (more details), 2.4 Å

PDB Description: human monoamine oxidase b in complex with n-(2-aminoethyl)-p-chlorobenzamide
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOP Domain Sequences for d1ojca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojca1 c.3.1.2 (A:3-289,A:402-501) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrligltti

SCOP Domain Coordinates for d1ojca1:

Click to download the PDB-style file with coordinates for d1ojca1.
(The format of our PDB-style files is described here.)

Timeline for d1ojca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojca2